Trajectory SP978
Force field:
martini_v2.2P
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 39816
Time step (fs) : 25
Software: GROMACS 2021.5
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 39816
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer:
Finisterrae III CESGA
Peptides: P278 AP01623
Lipids: POPE, POPG
Heteromolecules:
Ions: NA
Water model: PW
Peptides: P278 AP01623
Lipids: POPE, POPG
Heteromolecules:
Ions: NA
Water model: PW
Sequence :
FKLKGMARISCLPNGQWSNFPPKCIRECAMVSS
Total charge (e): +4
Number of residues: 33
By amino acid: Basic: 5 Acidic: 1 Hydrophobic: 17 Polar: 10 Electrostatic Dipolar Moment (e nm): 11.86
Longitudinal (e nm): 11.69 Transversal (e nm): 1.99 Hydrophobic Dipolar Moment (nm): 1.48
Longitudinal (nm): 0.31 Transversal (nm): 1.45 Secondary structure: Helix
Activity:
Download Files
ITP file. JSON file. PDB file.
Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet
Lipids
Membrane model for: POPG:POPE (1:3) (Gram-negative bacteria)
POPE
1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine
Total charge (e): 0
See POPE lipid
Download ITP File. Download PDB File.
POPG
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol
Total charge (e): -1
See POPG lipid
Download ITP File. Download PDB File.
Last snapshot
Total contacts per residue
Number of total contacts per residue type:
Number of contacts between each residue of the peptide backbone and the different lipid types, averaged over the last microsecond and using a cut-off of 0.6 nm.
Molecular Dynamics based descriptors
Average and standard deviation,
calculated using the autocorrelation function (for time
series)
or the width of the distribution, for the last microsecond
of
the trajectory
Area per lipid
Membrane (nm2): 0.638029000 ± 0.000913053
Upper leaflet (nm2): 0.638029000 ± 0.000913053
Lower leaflet (nm2): 0.638029000 ± 0.000913053
Average Z coordinate
Peptide (nm): 7.9291200 ± 0.0353431
First Residue (nm): 7.946100 ± 0.049893
Last Residue (nm): 8.1576400 ± 0.0519735
Membrane (nm): 6.02514000 ± 0.00836406
Upper leaflet Head Group (nm): 8.0162200 ± 0.0100338
Lower leaflet Head Group (nm): 4.03674000 ± 0.00667793
Bilayer Thickness (nm): 3.9794900 ± 0.0120529
Peptide insertion (nm): -0.0871009 ± 0.0367397
Contacts
Peptide - Water: 0.0 ± 0.0
Peptide - Head groups: 19.285000 ± 0.291181
Peptide - Tail groups: 18.142500 ± 0.479849
Tilt (°): 90.19870 ± 0.84389
Membrane (nm2): 0.638029000 ± 0.000913053
Upper leaflet (nm2): 0.638029000 ± 0.000913053
Lower leaflet (nm2): 0.638029000 ± 0.000913053
Average Z coordinate
Peptide (nm): 7.9291200 ± 0.0353431
First Residue (nm): 7.946100 ± 0.049893
Last Residue (nm): 8.1576400 ± 0.0519735
Membrane (nm): 6.02514000 ± 0.00836406
Upper leaflet Head Group (nm): 8.0162200 ± 0.0100338
Lower leaflet Head Group (nm): 4.03674000 ± 0.00667793
Bilayer Thickness (nm): 3.9794900 ± 0.0120529
Peptide insertion (nm): -0.0871009 ± 0.0367397
Contacts
Peptide - Water: 0.0 ± 0.0
Peptide - Head groups: 19.285000 ± 0.291181
Peptide - Tail groups: 18.142500 ± 0.479849
Tilt (°): 90.19870 ± 0.84389
PepDF:
5(ns): CVS
Displacement (nm): 0.5235900 ± 0.0219237
Precession(°): -1.091440 ± 0.698533
50(ns) CVS
Displacement (nm): 1.5443300 ± 0.0755793
Precession(°): -10.15960 ± 2.18351
100(ns) CVS
Displacement(nm): 2.233260 ± 0.106597
Precession(°): -17.96100 ± 3.21681
200(ns) CVS
Displacement(nm): 2.886640 ± 0.148911
Precession(°): -33.06310 ± 5.64427
Download JSON File.
5(ns): CVS
Displacement (nm): 0.5235900 ± 0.0219237
Precession(°): -1.091440 ± 0.698533
50(ns) CVS
Displacement (nm): 1.5443300 ± 0.0755793
Precession(°): -10.15960 ± 2.18351
100(ns) CVS
Displacement(nm): 2.233260 ± 0.106597
Precession(°): -17.96100 ± 3.21681
200(ns) CVS
Displacement(nm): 2.886640 ± 0.148911
Precession(°): -33.06310 ± 5.64427
Download JSON File.
Peptide Analyses
Peptide Displacement Fingerprint
(PepDF)
Lateral displacement vs
Rotational
Displacement along the trajectory, for different time
windows .















