Trajectory SP977

Force field: martini_v2.2P
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 45446
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer: Finisterrae III CESGA
Peptides: P278 AP01623
Lipids: POPC
Heteromolecules:
Ions: CL
Water model: PW

  Download all Compresed Files.


Sequence :
FKLKGMARISCLPNGQWSNFPPKCIRECAMVSS
Total charge (e): +4
Number of residues: 33
By amino acid:
  Basic: 5
  Acidic: 1
  Hydrophobic: 17
  Polar: 10
Electrostatic Dipolar Moment (e nm): 11.86
Longitudinal (e nm): 11.69
Transversal (e nm): 1.99
Hydrophobic Dipolar Moment (nm): 1.48
Longitudinal (nm): 0.31
Transversal (nm): 1.45
Secondary structure: Helix
Activity:

Download Files
  ITP file.
  JSON file.
  PDB file.

Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet

Lipids


Membrane model for: POPC (Healthy mammal)

POPC
2-oleoyl-sn-glycero-3-phosphocholine
Total charge (e): 0

  See POPC lipid
  Download ITP File.
  Download PDB File.
Last snapshot
Total contacts per residue
 
Contacts per residue
(normalized by number of beads in the residue)

Molecular Dynamics based descriptors
Average and standard deviation, calculated using the autocorrelation function (for time series) or the width of the distribution, for the last microsecond of the trajectory


Area per lipid
Membrane (nm2): 0.651226000 ± 0.000979964
Upper leaflet (nm2): 0.651226000 ± 0.000979964
Lower leaflet (nm2): 0.651226000 ± 0.000979964
Average Z coordinate
Peptide (nm): 8.4175700 ± 0.0338066
First Residue (nm): 8.4252100 ± 0.0396989
Last Residue (nm): 8.6505500 ± 0.0507209
Membrane (nm): 6.54765000 ± 0.00947587
Upper leaflet Head Group (nm): 8.514030 ± 0.011207
Lower leaflet Head Group (nm): 4.58472000 ± 0.00786595
Bilayer Thickness (nm): 3.929310 ± 0.013692
Peptide insertion (nm): -0.0964572 ± 0.0356158
Contacts
Peptide - Water: 0.0 ± 0.0
Peptide - Head groups: 19.400000 ± 0.318248
Peptide - Tail groups: 18.555000 ± 0.424136
Tilt (°): 90.187600 ± 0.761193
PepDF:
5(ns):  CVS
Displacement (nm): 0.5682630 ± 0.0248096
Precession(°): -0.224155 ± 0.785311
50(ns)  CVS
Displacement (nm): 1.74687 ± 0.08182
Precession(°): -1.48332 ± 2.70188
100(ns)  CVS
Displacement(nm): 2.49258 ± 0.12184
Precession(°): 0.234577 ± 2.860290
200(ns)  CVS
Displacement(nm): 3.300080 ± 0.184954
Precession(°): 2.63827 ± 3.83430

  Download JSON File.

Peptide Analyses


Peptide Displacement Fingerprint (PepDF)
Lateral displacement vs Rotational Displacement along the trajectory, for different time windows .

Density maps:
2D-density maps of lipids around the peptide along XY and YZ axis, calculated for each lipid type along the last microsecond.


Lipid-Peptide Analyses:


z-Position
Z-coordinate, averaged for differetn parts of the the system: peptide, membrane, first and last backbone (BB) residues and upper of lower leaflet lipids’ headgroups (HGs).
Minimum distance
Minimum distance (nm) between the peptide backbone and the lipids (headgroups and tailgroups).
Number of contacts
Number of contacts between the peptide backbone and the water or the lipids separated by lipid headgroups (HG) or lipid tails, using a cut-off of 0.6 nm.
Lateral density
Lateral density for the different components of the system: headgroups, tail groups, peptide and water.