Trajectory SP961

Force field: martini_v2.2P
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 45427
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer: Finisterrae III CESGA
Peptides: P270 AP01018
Lipids: POPC
Heteromolecules:
Ions: CL
Water model: PW

  Download all Compresed Files.


Sequence :
AFQTFKPDWNKIRYDAMKMQTSLGQMKKRFNL
Total charge (e): +5
Number of residues: 32
By amino acid:
  Basic: 7
  Acidic: 2
  Hydrophobic: 14
  Polar: 9
Electrostatic Dipolar Moment (e nm): 2.68
Longitudinal (e nm): 2.26
Transversal (e nm): 1.44
Hydrophobic Dipolar Moment (nm): 4.45
Longitudinal (nm): 4.15
Transversal (nm): 1.59
Secondary structure: Helix
Activity:

Download Files
  ITP file.
  JSON file.
  PDB file.

Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet

Lipids


Membrane model for: POPC (Healthy mammal)

POPC
2-oleoyl-sn-glycero-3-phosphocholine
Total charge (e): 0

  See POPC lipid
  Download ITP File.
  Download PDB File.
Last snapshot
Total contacts per residue
 
Contacts per residue
(normalized by number of beads in the residue)

Molecular Dynamics based descriptors
Average and standard deviation, calculated using the autocorrelation function (for time series) or the width of the distribution, for the last microsecond of the trajectory


Area per lipid
Membrane (nm2): 0.65016800 ± 0.00101539
Upper leaflet (nm2): 0.65016800 ± 0.00101539
Lower leaflet (nm2): 0.65016800 ± 0.00101539
Average Z coordinate
Peptide (nm): 4.4739400 ± 0.0304949
First Residue (nm): 4.5870200 ± 0.0409448
Last Residue (nm): 4.1291000 ± 0.0737465
Membrane (nm): 6.5592300 ± 0.0100293
Upper leaflet Head Group (nm): 8.52419 ± 0.01198
Lower leaflet Head Group (nm): 4.59358000 ± 0.00833793
Bilayer Thickness (nm): 3.9306100 ± 0.0145959
Peptide insertion (nm): 0.1196340 ± 0.0316142
Contacts
Peptide - Water: 0.0 ± 0.0
Peptide - Head groups: 18.362500 ± 0.422587
Peptide - Tail groups: 14.990000 ± 0.362523
Tilt (°): 87.73810 ± 1.05576
PepDF:
5(ns):  CVS
Displacement (nm): 0.5861310 ± 0.0259854
Precession(°): -0.967767 ± 0.837059
50(ns)  CVS
Displacement (nm): 1.6506200 ± 0.0859777
Precession(°): -10.18280 ± 2.67195
100(ns)  CVS
Displacement(nm): 2.484920 ± 0.115141
Precession(°): -20.79550 ± 4.29925
200(ns)  CVS
Displacement(nm): 3.773360 ± 0.178156
Precession(°): -38.92350 ± 6.71496

  Download JSON File.

Peptide Analyses


Peptide Displacement Fingerprint (PepDF)
Lateral displacement vs Rotational Displacement along the trajectory, for different time windows .

Density maps:
2D-density maps of lipids around the peptide along XY and YZ axis, calculated for each lipid type along the last microsecond.


Lipid-Peptide Analyses:


z-Position
Z-coordinate, averaged for differetn parts of the the system: peptide, membrane, first and last backbone (BB) residues and upper of lower leaflet lipids’ headgroups (HGs).
Minimum distance
Minimum distance (nm) between the peptide backbone and the lipids (headgroups and tailgroups).
Number of contacts
Number of contacts between the peptide backbone and the water or the lipids separated by lipid headgroups (HG) or lipid tails, using a cut-off of 0.6 nm.
Lateral density
Lateral density for the different components of the system: headgroups, tail groups, peptide and water.