Trajectory SP780

Force field: martini_v2.2
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 19190
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer: Finisterrae III CESGA
Peptides: P180 AP03640
Lipids: POPC
Heteromolecules:
Ions: CL
Water model: W

  Download all Compresed Files.


Sequence :
ATFLRIVAQLSSKAAKWALDNKDKVLKWIRDGMAI-
DWIIDKINDIVG

Total charge (e): +2
Number of residues: 47
By amino acid:
  Basic: 8
  Acidic: 6
  Hydrophobic: 27
  Polar: 6
Electrostatic Dipolar Moment (e nm): 19.75
Longitudinal (e nm): 19.63
Transversal (e nm): 2.19
Hydrophobic Dipolar Moment (nm): 2.76
Longitudinal (nm): 1.19
Transversal (nm): 2.49
Secondary structure: Helix
Activity:

Download Files
  ITP file.
  JSON file.
  PDB file.

Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet

Lipids


Membrane model for: POPC (Healthy mammal)

POPC
2-oleoyl-sn-glycero-3-phosphocholine
Total charge (e): 0

  See POPC lipid
  Download ITP File.
  Download PDB File.
Last snapshot
Total contacts per residue
 
Contacts per residue
(normalized by number of beads in the residue)

Molecular Dynamics based descriptors
Average and standard deviation, calculated using the autocorrelation function (for time series) or the width of the distribution, for the last microsecond of the trajectory


Area per lipid
Membrane (nm2): 0.643124000 ± 0.000895924
Upper leaflet (nm2): 0.643124000 ± 0.000895924
Lower leaflet (nm2): 0.643124000 ± 0.000895924
Average Z coordinate
Peptide (nm): 3.6876900 ± 0.0523686
First Residue (nm): 1.985600 ± 0.139249
Last Residue (nm): 4.9776300 ± 0.0400195
Membrane (nm): 6.81862000 ± 0.00965068
Upper leaflet Head Group (nm): 8.777880 ± 0.011419
Lower leaflet Head Group (nm): 4.85931000 ± 0.00800642
Bilayer Thickness (nm): 3.9185700 ± 0.0139462
Peptide insertion (nm): 1.1716200 ± 0.0529771
Contacts
Peptide - Water: 118.38200 ± 1.07437
Peptide - Head groups: 12.997500 ± 0.328008
Peptide - Tail groups: 9.240000 ± 0.234834
Tilt (°): 112.33000 ± 4.17951
PepDF:
5(ns):  CVS
Displacement (nm): 0.7338140 ± 0.0300184
Precession(°): 1.20647 ± 1.45094
50(ns)  CVS
Displacement (nm): 2.053140 ± 0.104978
Precession(°): 11.00780 ± 4.81523
100(ns)  CVS
Displacement(nm): 2.573870 ± 0.129759
Precession(°): 22.6063 ± 5.8714
200(ns)  CVS
Displacement(nm): 2.861150 ± 0.139172
Precession(°): 47.94190 ± 7.28183

  Download JSON File.

Peptide Analyses


Peptide Displacement Fingerprint (PepDF)
Lateral displacement vs Rotational Displacement along the trajectory, for different time windows .

Density maps:
2D-density maps of lipids around the peptide along XY and YZ axis, calculated for each lipid type along the last microsecond.


Lipid-Peptide Analyses:


z-Position
Z-coordinate, averaged for differetn parts of the the system: peptide, membrane, first and last backbone (BB) residues and upper of lower leaflet lipids’ headgroups (HGs).
Minimum distance
Minimum distance (nm) between the peptide backbone and the lipids (headgroups and tailgroups).
Number of contacts
Number of contacts between the peptide backbone and the water or the lipids separated by lipid headgroups (HG) or lipid tails, using a cut-off of 0.6 nm.
Lateral density
Lateral density for the different components of the system: headgroups, tail groups, peptide and water.