Trajectory SP704

Force field: martini_v2.2
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 19196
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer: Finisterrae III CESGA
Peptides: P142 AP02031
Lipids: POPC
Heteromolecules:
Ions: CL
Water model: W

  Download all Compresed Files.


Sequence :
PFKKLEKVGRNIRDGIIKAGPAVAVIGQATSIARP-
TGK

Total charge (e): +6
Number of residues: 38
By amino acid:
  Basic: 8
  Acidic: 2
  Hydrophobic: 23
  Polar: 5
Electrostatic Dipolar Moment (e nm): 8.71
Longitudinal (e nm): 8.4
Transversal (e nm): 2.31
Hydrophobic Dipolar Moment (nm): 2.77
Longitudinal (nm): 1.6
Transversal (nm): 2.25
Secondary structure: Helix
Activity:

Download Files
  ITP file.
  JSON file.
  PDB file.

Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet

Lipids


Membrane model for: POPC (Healthy mammal)

POPC
2-oleoyl-sn-glycero-3-phosphocholine
Total charge (e): 0

  See POPC lipid
  Download ITP File.
  Download PDB File.
Last snapshot
Total contacts per residue
 
Contacts per residue
(normalized by number of beads in the residue)

Molecular Dynamics based descriptors
Average and standard deviation, calculated using the autocorrelation function (for time series) or the width of the distribution, for the last microsecond of the trajectory


Area per lipid
Membrane (nm2): 0.64549600 ± 0.00115489
Upper leaflet (nm2): 0.64549600 ± 0.00115489
Lower leaflet (nm2): 0.64549600 ± 0.00115489
Average Z coordinate
Peptide (nm): 4.9587000 ± 0.0287769
First Residue (nm): 5.0192400 ± 0.0410063
Last Residue (nm): 4.7921300 ± 0.0442759
Membrane (nm): 6.8014100 ± 0.0119754
Upper leaflet Head Group (nm): 8.7550100 ± 0.0139418
Lower leaflet Head Group (nm): 4.84270000 ± 0.00939363
Bilayer Thickness (nm): 3.9123100 ± 0.0168111
Peptide insertion (nm): -0.1160000 ± 0.0302713
Contacts
Peptide - Water: 46.78500 ± 1.00233
Peptide - Head groups: 20.93000 ± 0.33979
Peptide - Tail groups: 18.407500 ± 0.342492
Tilt (°): 88.701100 ± 0.715317
PepDF:
5(ns):  CVS
Displacement (nm): 0.5528530 ± 0.0233557
Precession(°): -0.0906274 ± 0.8492330
50(ns)  CVS
Displacement (nm): 1.3986100 ± 0.0648653
Precession(°): 1.08746 ± 2.62947
100(ns)  CVS
Displacement(nm): 1.953420 ± 0.102256
Precession(°): 2.43094 ± 3.73767
200(ns)  CVS
Displacement(nm): 2.462420 ± 0.143508
Precession(°): 11.30270 ± 6.08757

  Download JSON File.

Peptide Analyses


Peptide Displacement Fingerprint (PepDF)
Lateral displacement vs Rotational Displacement along the trajectory, for different time windows .

Density maps:
2D-density maps of lipids around the peptide along XY and YZ axis, calculated for each lipid type along the last microsecond.


Lipid-Peptide Analyses:


z-Position
Z-coordinate, averaged for differetn parts of the the system: peptide, membrane, first and last backbone (BB) residues and upper of lower leaflet lipids’ headgroups (HGs).
Minimum distance
Minimum distance (nm) between the peptide backbone and the lipids (headgroups and tailgroups).
Number of contacts
Number of contacts between the peptide backbone and the water or the lipids separated by lipid headgroups (HG) or lipid tails, using a cut-off of 0.6 nm.
Lateral density
Lateral density for the different components of the system: headgroups, tail groups, peptide and water.