Trajectory SP653
Force field:
martini_v2.2
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 17386
Time step (fs) : 25
Software: GROMACS 2021.5
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 17386
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer:
Finisterrae III CESGA
Peptides: P116 AP00310
Lipids: POPE, POPG
Heteromolecules:
Ions: NA
Water model: W
Peptides: P116 AP00310
Lipids: POPE, POPG
Heteromolecules:
Ions: NA
Water model: W
Sequence :
LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTE-
S
Total charge (e): +6
Number of residues: 36
By amino acid: Basic: 11 Acidic: 5 Hydrophobic: 15 Polar: 5 Electrostatic Dipolar Moment (e nm): 9.47
Longitudinal (e nm): 9.43 Transversal (e nm): 0.87 Hydrophobic Dipolar Moment (nm): 2.66
Longitudinal (nm): 0.31 Transversal (nm): 2.65 Secondary structure: Helix
Activity:
Download Files
ITP file. JSON file. PDB file.
Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet
Lipids
Membrane model for: POPG:POPE (1:3) (Gram-negative bacteria)
POPE
1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine
Total charge (e): 0
See POPE lipid
Download ITP File. Download PDB File.
POPG
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol
Total charge (e): -1
See POPG lipid
Download ITP File. Download PDB File.
Last snapshot
Total contacts per residue
Number of total contacts per residue type:
Number of contacts between each residue of the peptide backbone and the different lipid types, averaged over the last microsecond and using a cut-off of 0.6 nm.
Molecular Dynamics based descriptors
Average and standard deviation,
calculated using the autocorrelation function (for time
series)
or the width of the distribution, for the last microsecond
of
the trajectory
Area per lipid
Membrane (nm2): 0.606992000 ± 0.000889693
Upper leaflet (nm2): 0.606992000 ± 0.000889693
Lower leaflet (nm2): 0.606992000 ± 0.000889693
Average Z coordinate
Peptide (nm): 8.6592000 ± 0.0262397
First Residue (nm): 8.5003700 ± 0.0425309
Last Residue (nm): 9.0517400 ± 0.0440012
Membrane (nm): 6.50440000 ± 0.00944725
Upper leaflet Head Group (nm): 8.5283600 ± 0.0116426
Lower leaflet Head Group (nm): 4.48173000 ± 0.00757905
Bilayer Thickness (nm): 4.0466300 ± 0.0138922
Peptide insertion (nm): 0.1308380 ± 0.0287067
Contacts
Peptide - Water: 57.730000 ± 0.935499
Peptide - Head groups: 20.395000 ± 0.321044
Peptide - Tail groups: 17.652500 ± 0.347103
Tilt (°): 88.054300 ± 0.647823
Membrane (nm2): 0.606992000 ± 0.000889693
Upper leaflet (nm2): 0.606992000 ± 0.000889693
Lower leaflet (nm2): 0.606992000 ± 0.000889693
Average Z coordinate
Peptide (nm): 8.6592000 ± 0.0262397
First Residue (nm): 8.5003700 ± 0.0425309
Last Residue (nm): 9.0517400 ± 0.0440012
Membrane (nm): 6.50440000 ± 0.00944725
Upper leaflet Head Group (nm): 8.5283600 ± 0.0116426
Lower leaflet Head Group (nm): 4.48173000 ± 0.00757905
Bilayer Thickness (nm): 4.0466300 ± 0.0138922
Peptide insertion (nm): 0.1308380 ± 0.0287067
Contacts
Peptide - Water: 57.730000 ± 0.935499
Peptide - Head groups: 20.395000 ± 0.321044
Peptide - Tail groups: 17.652500 ± 0.347103
Tilt (°): 88.054300 ± 0.647823
PepDF:
5(ns): CVS
Displacement (nm): 0.5280480 ± 0.0215523
Precession(°): 1.075310 ± 0.926979
50(ns) CVS
Displacement (nm): 1.5899100 ± 0.0758799
Precession(°): 9.63975 ± 2.61042
100(ns) CVS
Displacement(nm): 2.263740 ± 0.120885
Precession(°): 15.3290 ± 3.2145
200(ns) CVS
Displacement(nm): 3.248940 ± 0.136571
Precession(°): 23.31850 ± 4.31239
Download JSON File.
5(ns): CVS
Displacement (nm): 0.5280480 ± 0.0215523
Precession(°): 1.075310 ± 0.926979
50(ns) CVS
Displacement (nm): 1.5899100 ± 0.0758799
Precession(°): 9.63975 ± 2.61042
100(ns) CVS
Displacement(nm): 2.263740 ± 0.120885
Precession(°): 15.3290 ± 3.2145
200(ns) CVS
Displacement(nm): 3.248940 ± 0.136571
Precession(°): 23.31850 ± 4.31239
Download JSON File.
Peptide Analyses
Peptide Displacement Fingerprint
(PepDF)
Lateral displacement vs
Rotational
Displacement along the trajectory, for different time
windows .















