Trajectory SP636
Force field:
martini_v2.2P
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (parrinello-rahman semiisotropic)
Number of particles: 32570
Time step (fs) : 25
Software: GROMACS 2020
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (parrinello-rahman semiisotropic)
Number of particles: 32570
Time step (fs) : 25
Software: GROMACS 2020
Supercomputer:
Finisterrae II CESGA
Peptides: P106 NC00010
Lipids: POPE, POPG
Heteromolecules:
Ions: NA
Water model: PW
Peptides: P106 NC00010
Lipids: POPE, POPG
Heteromolecules:
Ions: NA
Water model: PW
Sequence :
QSWLVPSTITTCCGYSPGTMCPPCMCTNTC
Total charge (e): 0
Number of residues: 30
By amino acid: Basic: 0 Acidic: 0 Hydrophobic: 12 Polar: 18 Electrostatic Dipolar Moment (e nm): 4.77
Longitudinal (e nm): 4.77 Transversal (e nm): 0.04 Hydrophobic Dipolar Moment (nm): 2.41
Longitudinal (nm): 1.72 Transversal (nm): 1.69 Secondary structure: Helix
Activity:
Download Files
ITP file. JSON file. PDB file.
Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet
Lipids
Membrane model for: POPG:POPE (1:3) (Gram-negative bacteria)
POPE
1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine
Total charge (e): 0
See POPE lipid
Download ITP File. Download PDB File.
POPG
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol
Total charge (e): -1
See POPG lipid
Download ITP File. Download PDB File.
Last snapshot
Total contacts per residue
Number of total contacts per residue type:
Number of contacts between each residue of the peptide backbone and the different lipid types, averaged over the last microsecond and using a cut-off of 0.6 nm.
Molecular Dynamics based descriptors
Average and standard deviation,
calculated using the autocorrelation function (for time
series)
or the width of the distribution, for the last microsecond
of
the trajectory
Area per lipid
Membrane (nm2): 0.65199 ± 0.00070
Upper leaflet (nm2): 0.65199 ± 0.00070
Lower leaflet (nm2): 0.65199 ± 0.00070
Average Z coordinate
Peptide (nm): 6.832 ± 0.023
First Residue (nm): 6.878 ± 0.026
Last Residue (nm): 7.236 ± 0.035
Membrane (nm): 5.0499 ± 0.0052
Upper leaflet Head Group (nm): 7.0246 ± 0.0066
Lower leaflet Head Group (nm): 3.0785 ± 0.0040
Bilayer Thickness (nm): 3.9461 ± 0.0077
Peptide insertion (nm): -0.193 ± 0.024
Contacts
Peptide - Water: 40.69 ± 0.67
Peptide - Head groups: 17.11 ± 0.21
Peptide - Tail groups: 16.27 ± 0.22
Tilt (°): 86.89 ± 0.50
Membrane (nm2): 0.65199 ± 0.00070
Upper leaflet (nm2): 0.65199 ± 0.00070
Lower leaflet (nm2): 0.65199 ± 0.00070
Average Z coordinate
Peptide (nm): 6.832 ± 0.023
First Residue (nm): 6.878 ± 0.026
Last Residue (nm): 7.236 ± 0.035
Membrane (nm): 5.0499 ± 0.0052
Upper leaflet Head Group (nm): 7.0246 ± 0.0066
Lower leaflet Head Group (nm): 3.0785 ± 0.0040
Bilayer Thickness (nm): 3.9461 ± 0.0077
Peptide insertion (nm): -0.193 ± 0.024
Contacts
Peptide - Water: 40.69 ± 0.67
Peptide - Head groups: 17.11 ± 0.21
Peptide - Tail groups: 16.27 ± 0.22
Tilt (°): 86.89 ± 0.50
PepDF:
5(ns): CVS
Displacement (nm): 0.494 ± 0.028
Precession(°): -1.3 ± 1.4
50(ns) CVS
Displacement (nm): 1.44 ± 0.22
Precession(°): -14.2 ± 8.1
100(ns) CVS
Displacement(nm): 2.17 ± 0.38
Precession(°): -28.0 ± 18.0
200(ns) CVS
Displacement(nm): 3.23 ± 0.86
Precession(°): -58.0 ± 49.0
Download JSON File.
5(ns): CVS
Displacement (nm): 0.494 ± 0.028
Precession(°): -1.3 ± 1.4
50(ns) CVS
Displacement (nm): 1.44 ± 0.22
Precession(°): -14.2 ± 8.1
100(ns) CVS
Displacement(nm): 2.17 ± 0.38
Precession(°): -28.0 ± 18.0
200(ns) CVS
Displacement(nm): 3.23 ± 0.86
Precession(°): -58.0 ± 49.0
Download JSON File.
Peptide Analyses
Peptide Displacement Fingerprint
(PepDF)
Lateral displacement vs
Rotational
Displacement along the trajectory, for different time
windows .















