Trajectory SP321
Force field:
martini_v2.2P
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (parrinello-rahman semiisotropic)
Number of particles: 23544
Time step (fs) : 25
Software: GROMACS 2020
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (parrinello-rahman semiisotropic)
Number of particles: 23544
Time step (fs) : 25
Software: GROMACS 2020
Supercomputer:
Finisterrae II CESGA
Peptides: P54 DRAMP00008
Lipids: POPC
Heteromolecules:
Ions: NA
Water model: PW
Peptides: P54 DRAMP00008
Lipids: POPC
Heteromolecules:
Ions: NA
Water model: PW
Sequence :
CSTNTFSLSDYWGNNGAWCTLTHECMAWCK
Total charge (e): -1
Number of residues: 30
By amino acid: Basic: 2 Acidic: 2 Hydrophobic: 11 Polar: 15 Electrostatic Dipolar Moment (e nm): 3.29
Longitudinal (e nm): 3.03 Transversal (e nm): 1.28 Hydrophobic Dipolar Moment (nm): 3.9
Longitudinal (nm): 3.59 Transversal (nm): 1.52 Secondary structure: Helix
Activity:
Download Files
ITP file. JSON file. PDB file.
Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet
Lipids
Membrane model for: POPC (Healthy mammal)
POPC
2-oleoyl-sn-glycero-3-phosphocholine
Total charge (e): 0
See POPC lipid
Download ITP File. Download PDB File.
Last snapshot
Total contacts per residue
Number of total contacts per residue type:
Number of contacts between each residue of the peptide backbone and the different lipid types, averaged over the last microsecond and using a cut-off of 0.6 nm.
Contacts per residue
(normalized by total number of beads of the amino acid):
Number of contacts between each residue of the peptide backbone and the different lipid types, averaged over the last microsecond and using a cut-off of 0.6 nm.
Molecular Dynamics based descriptors
Average and standard deviation,
calculated using the autocorrelation function (for time
series)
or the width of the distribution, for the last microsecond
of
the trajectory
Area per lipid
Membrane (nm2): 0.65586 ± 0.00076
Upper leaflet (nm2): 0.65586 ± 0.00076
Lower leaflet (nm2): 0.65586 ± 0.00076
Average Z coordinate
Peptide (nm): 6.06 ± 0.14
First Residue (nm): 5.896 ± 0.038
Last Residue (nm): 6.44 ± 0.30
Membrane (nm): 3.9594 ± 0.0046
Upper leaflet Head Group (nm): 5.9198 ± 0.0060
Lower leaflet Head Group (nm): 1.9992 ± 0.0032
Bilayer Thickness (nm): 3.9206 ± 0.0068
Peptide insertion (nm): 0.14 ± 0.14
Contacts
Peptide - Water: 60.4 ± 8.2
Peptide - Head groups: 17.2 ± 1.2
Peptide - Tail groups: 13.7 ± 2.0
Tilt (°): 83.8 ± 4.9
Membrane (nm2): 0.65586 ± 0.00076
Upper leaflet (nm2): 0.65586 ± 0.00076
Lower leaflet (nm2): 0.65586 ± 0.00076
Average Z coordinate
Peptide (nm): 6.06 ± 0.14
First Residue (nm): 5.896 ± 0.038
Last Residue (nm): 6.44 ± 0.30
Membrane (nm): 3.9594 ± 0.0046
Upper leaflet Head Group (nm): 5.9198 ± 0.0060
Lower leaflet Head Group (nm): 1.9992 ± 0.0032
Bilayer Thickness (nm): 3.9206 ± 0.0068
Peptide insertion (nm): 0.14 ± 0.14
Contacts
Peptide - Water: 60.4 ± 8.2
Peptide - Head groups: 17.2 ± 1.2
Peptide - Tail groups: 13.7 ± 2.0
Tilt (°): 83.8 ± 4.9
PepDF:
5(ns): CVS
Displacement (nm): 0.516 ± 0.028
Precession(°): 0.1 ± 1.8
50(ns) CVS
Displacement (nm): 1.69 ± 0.23
Precession(°): 2.0 ± 15.0
100(ns) CVS
Displacement(nm): 2.45 ± 0.74
Precession(°): 3.0 ± 27.0
200(ns) CVS
Displacement(nm): 3.3 ± 1.1
Precession(°): -2.0 ± 27.0
Download JSON File.
5(ns): CVS
Displacement (nm): 0.516 ± 0.028
Precession(°): 0.1 ± 1.8
50(ns) CVS
Displacement (nm): 1.69 ± 0.23
Precession(°): 2.0 ± 15.0
100(ns) CVS
Displacement(nm): 2.45 ± 0.74
Precession(°): 3.0 ± 27.0
200(ns) CVS
Displacement(nm): 3.3 ± 1.1
Precession(°): -2.0 ± 27.0
Download JSON File.
Peptide Analyses
Peptide Displacement Fingerprint
(PepDF)
Lateral displacement vs
Rotational
Displacement along the trajectory, for different time
windows .
Tilt angle: 
Peptide tilt angle evolution, defined as the angle between the peptide helical axis and the bilayer normal .
Peptide spin: 
Evolution of the angle formed by the transversal component of the hydrophobic dipolar moment and a vector transversal to the peptide pointing outwards the membrane.
Lipid Analyses:
Area per lipid
In this system both leaflets have the same number of lipids, thus the values for their APL are overlaping in the plot
Density maps:
2D-density maps of lipids around the
peptide
along XY and YZ axis, calculated for each lipid type along the
last
microsecond.
Lipid-Peptide Analyses:
z-Position
Z-coordinate, averaged for
differetn
parts of the the system: peptide, membrane, first and
last
backbone (BB) residues and upper of lower leaflet
lipids’
headgroups (HGs).
Minimum distance
Minimum distance (nm) between the
peptide backbone and the lipids (headgroups and
tailgroups).
Number of contacts
Number of contacts between the
peptide backbone and the water or the lipids separated
by
lipid headgroups (HG) or lipid tails, using a cut-off of
0.6
nm.
Lateral density
Lateral density for the different
components of the system: headgroups, tail groups,
peptide
and water.