Trajectory SP1338

Force field: martini_v3
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 19211
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer: Finisterrae III CESGA
Peptides: P458 AP03745
Lipids: POPC
Heteromolecules:
Ions: CL
Water model: W

  Download all Compresed Files.


Sequence :
WKIFKRIEKVGRNVRDGVIKAGPAVAVLGQAKALG-
K

Total charge (e): +7
Number of residues: 36
By amino acid:
  Basic: 9
  Acidic: 2
  Hydrophobic: 23
  Polar: 2
Electrostatic Dipolar Moment (e nm): 8.84
Longitudinal (e nm): 8.67
Transversal (e nm): 1.74
Hydrophobic Dipolar Moment (nm): 2.8
Longitudinal (nm): 2.21
Transversal (nm): 1.72
Secondary structure: Helix
Activity:

Download Files
  ITP file.
  JSON file.
  PDB file.

Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet

Lipids


Membrane model for: POPC (Healthy mammal)

POPC
2-oleoyl-sn-glycero-3-phosphocholine
Total charge (e): 0

  See POPC lipid
  Download ITP File.
  Download PDB File.
Last snapshot
Total contacts per residue
 
Contacts per residue
(normalized by number of beads in the residue)

Molecular Dynamics based descriptors
Average and standard deviation, calculated using the autocorrelation function (for time series) or the width of the distribution, for the last microsecond of the trajectory


Area per lipid
Membrane (nm2): 0.64893500 ± 0.00109067
Upper leaflet (nm2): 0.64893500 ± 0.00109067
Lower leaflet (nm2): 0.64893500 ± 0.00109067
Average Z coordinate
Peptide (nm): 9.765360 ± 0.100208
First Residue (nm): 8.8673000 ± 0.0588078
Last Residue (nm): 10.894300 ± 0.241129
Membrane (nm): 6.8214700 ± 0.0112385
Upper leaflet Head Group (nm): 8.7614400 ± 0.0133592
Lower leaflet Head Group (nm): 4.88099000 ± 0.00910393
Bilayer Thickness (nm): 3.8804500 ± 0.0161663
Peptide insertion (nm): 1.003920 ± 0.101095
Contacts
Peptide - Water: 104.9020 ± 2.1489
Peptide - Head groups: 10.317500 ± 0.734242
Peptide - Tail groups: 7.575000 ± 0.491777
Tilt (°): 63.91200 ± 3.47964
PepDF:
5(ns):  CVS
Displacement (nm): 0.9194140 ± 0.0385295
Precession(°): 2.71110 ± 2.41146
50(ns)  CVS
Displacement (nm): 2.515020 ± 0.111885
Precession(°): 26.22490 ± 8.24213
100(ns)  CVS
Displacement(nm): 3.008850 ± 0.130919
Precession(°): 53.9349 ± 11.7753
200(ns)  CVS
Displacement(nm): 3.175120 ± 0.190371
Precession(°): 83.1428 ± 13.3948

  Download JSON File.

Peptide Analyses


Peptide Displacement Fingerprint (PepDF)
Lateral displacement vs Rotational Displacement along the trajectory, for different time windows .

Density maps:
2D-density maps of lipids around the peptide along XY and YZ axis, calculated for each lipid type along the last microsecond.


Lipid-Peptide Analyses:


z-Position
Z-coordinate, averaged for differetn parts of the the system: peptide, membrane, first and last backbone (BB) residues and upper of lower leaflet lipids’ headgroups (HGs).
Minimum distance
Minimum distance (nm) between the peptide backbone and the lipids (headgroups and tailgroups).
Number of contacts
Number of contacts between the peptide backbone and the water or the lipids separated by lipid headgroups (HG) or lipid tails, using a cut-off of 0.6 nm.
Lateral density
Lateral density for the different components of the system: headgroups, tail groups, peptide and water.