Trajectory SP1331

Force field: martini_v3
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 17407
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer: Finisterrae III CESGA
Peptides: P454 AP03640
Lipids: POPE, POPG
Heteromolecules:
Ions: NA
Water model: W

  Download all Compresed Files.


Sequence :
ATFLRIVAQLSSKAAKWALDNKDKVLKWIRDGMAI-
DWIIDKINDIVG

Total charge (e): +2
Number of residues: 47
By amino acid:
  Basic: 8
  Acidic: 6
  Hydrophobic: 27
  Polar: 6
Electrostatic Dipolar Moment (e nm): 19.63
Longitudinal (e nm): 19.5
Transversal (e nm): 2.25
Hydrophobic Dipolar Moment (nm): 2.74
Longitudinal (nm): 1.12
Transversal (nm): 2.5
Secondary structure: Helix
Activity:

Download Files
  ITP file.
  JSON file.
  PDB file.

Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet

Lipids


Membrane model for: POPG:POPE (1:3) (Gram-negative bacteria)

POPE
1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine
Total charge (e): 0

  See POPE lipid
  Download ITP File.
  Download PDB File.
POPG
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol
Total charge (e): -1

  See POPG lipid
  Download ITP File.
  Download PDB File.
Last snapshot
Total contacts per residue
 
Contacts per residue
(normalized by number of beads in the residue)

Molecular Dynamics based descriptors
Average and standard deviation, calculated using the autocorrelation function (for time series) or the width of the distribution, for the last microsecond of the trajectory


Area per lipid
Membrane (nm2): 0.614279000 ± 0.000976266
Upper leaflet (nm2): 0.614279000 ± 0.000976266
Lower leaflet (nm2): 0.614279000 ± 0.000976266
Average Z coordinate
Peptide (nm): 9.169070 ± 0.244185
First Residue (nm): 9.171230 ± 0.750848
Last Residue (nm): 9.498530 ± 0.382796
Membrane (nm): 6.38838000 ± 0.00979234
Upper leaflet Head Group (nm): 8.3963000 ± 0.0122187
Lower leaflet Head Group (nm): 4.37783000 ± 0.00775574
Bilayer Thickness (nm): 4.0184700 ± 0.0144723
Peptide insertion (nm): 0.772773 ± 0.244490
Contacts
Peptide - Water: 118.4820 ± 13.0438
Peptide - Head groups: 15.00250 ± 2.58003
Peptide - Tail groups: 12.94000 ± 3.13967
Tilt (°): 89.55710 ± 6.64018
PepDF:
5(ns):  CVS
Displacement (nm): 0.7482440 ± 0.0312756
Precession(°): -0.0856252 ± 0.7126460
50(ns)  CVS
Displacement (nm): 2.1538000 ± 0.0984218
Precession(°): -0.720652 ± 1.582320
100(ns)  CVS
Displacement(nm): 2.955890 ± 0.165457
Precession(°): -1.56716 ± 1.30456
200(ns)  CVS
Displacement(nm): 3.884750 ± 0.184357
Precession(°): -2.72749 ± 1.53952

  Download JSON File.

Peptide Analyses


Peptide Displacement Fingerprint (PepDF)
Lateral displacement vs Rotational Displacement along the trajectory, for different time windows .

Density maps:
2D-density maps of lipids around the peptide along XY and YZ axis, calculated for each lipid type along the last microsecond.


Lipid-Peptide Analyses:


z-Position
Z-coordinate, averaged for differetn parts of the the system: peptide, membrane, first and last backbone (BB) residues and upper of lower leaflet lipids’ headgroups (HGs).
Minimum distance
Minimum distance (nm) between the peptide backbone and the lipids (headgroups and tailgroups).
Number of contacts
Number of contacts between the peptide backbone and the water or the lipids separated by lipid headgroups (HG) or lipid tails, using a cut-off of 0.6 nm.
Lateral density
Lateral density for the different components of the system: headgroups, tail groups, peptide and water.