Trajectory SP1304

Force field: martini_v3
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 19212
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer: Finisterrae III CESGA
Peptides: P441 AP03166
Lipids: POPC
Heteromolecules:
Ions: CL
Water model: W

  Download all Compresed Files.


Sequence :
FSSLFKAGAKYLLKQVGKAGAQQLACKAANNC
Total charge (e): +5
Number of residues: 32
By amino acid:
  Basic: 5
  Acidic: 0
  Hydrophobic: 17
  Polar: 10
Electrostatic Dipolar Moment (e nm): 7.1
Longitudinal (e nm): 6.87
Transversal (e nm): 1.8
Hydrophobic Dipolar Moment (nm): 6.87
Longitudinal (nm): 6.78
Transversal (nm): 1.1
Secondary structure: Helix
Activity:

Download Files
  ITP file.
  JSON file.
  PDB file.

Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet

Lipids


Membrane model for: POPC (Healthy mammal)

POPC
2-oleoyl-sn-glycero-3-phosphocholine
Total charge (e): 0

  See POPC lipid
  Download ITP File.
  Download PDB File.
Last snapshot
Total contacts per residue
 
Contacts per residue
(normalized by number of beads in the residue)

Molecular Dynamics based descriptors
Average and standard deviation, calculated using the autocorrelation function (for time series) or the width of the distribution, for the last microsecond of the trajectory


Area per lipid
Membrane (nm2): 0.64917300 ± 0.00116798
Upper leaflet (nm2): 0.64917300 ± 0.00116798
Lower leaflet (nm2): 0.64917300 ± 0.00116798
Average Z coordinate
Peptide (nm): 4.2918200 ± 0.0572554
First Residue (nm): 4.9184900 ± 0.0409557
Last Residue (nm): 3.375710 ± 0.131295
Membrane (nm): 6.8212600 ± 0.0118776
Upper leaflet Head Group (nm): 8.7613400 ± 0.0143321
Lower leaflet Head Group (nm): 4.8819800 ± 0.0097629
Bilayer Thickness (nm): 3.8793700 ± 0.0173414
Peptide insertion (nm): 0.5901600 ± 0.0580818
Contacts
Peptide - Water: 81.06500 ± 2.12002
Peptide - Head groups: 12.127500 ± 0.658316
Peptide - Tail groups: 8.335000 ± 0.464006
Tilt (°): 73.49280 ± 2.07166
PepDF:
5(ns):  CVS
Displacement (nm): 0.8280430 ± 0.0362733
Precession(°): 1.69317 ± 2.03156
50(ns)  CVS
Displacement (nm): 2.56929 ± 0.14371
Precession(°): 14.91110 ± 6.86063
100(ns)  CVS
Displacement(nm): 4.035240 ± 0.192223
Precession(°): 36.20210 ± 9.87126
200(ns)  CVS
Displacement(nm): 5.150430 ± 0.389529
Precession(°): 97.8388 ± 11.1025

  Download JSON File.

Peptide Analyses


Peptide Displacement Fingerprint (PepDF)
Lateral displacement vs Rotational Displacement along the trajectory, for different time windows .

Density maps:
2D-density maps of lipids around the peptide along XY and YZ axis, calculated for each lipid type along the last microsecond.


Lipid-Peptide Analyses:


z-Position
Z-coordinate, averaged for differetn parts of the the system: peptide, membrane, first and last backbone (BB) residues and upper of lower leaflet lipids’ headgroups (HGs).
Minimum distance
Minimum distance (nm) between the peptide backbone and the lipids (headgroups and tailgroups).
Number of contacts
Number of contacts between the peptide backbone and the water or the lipids separated by lipid headgroups (HG) or lipid tails, using a cut-off of 0.6 nm.
Lateral density
Lateral density for the different components of the system: headgroups, tail groups, peptide and water.