Trajectory SP1254

Force field: martini_v3
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 19210
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer: Finisterrae III CESGA
Peptides: P416 AP02031
Lipids: POPC
Heteromolecules:
Ions: CL
Water model: W

  Download all Compresed Files.


Sequence :
PFKKLEKVGRNIRDGIIKAGPAVAVIGQATSIARP-
TGK

Total charge (e): +6
Number of residues: 38
By amino acid:
  Basic: 8
  Acidic: 2
  Hydrophobic: 23
  Polar: 5
Electrostatic Dipolar Moment (e nm): 9.19
Longitudinal (e nm): 8.87
Transversal (e nm): 2.39
Hydrophobic Dipolar Moment (nm): 2.73
Longitudinal (nm): 1.53
Transversal (nm): 2.26
Secondary structure: Helix
Activity:

Download Files
  ITP file.
  JSON file.
  PDB file.

Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet

Lipids


Membrane model for: POPC (Healthy mammal)

POPC
2-oleoyl-sn-glycero-3-phosphocholine
Total charge (e): 0

  See POPC lipid
  Download ITP File.
  Download PDB File.
Last snapshot
Total contacts per residue
 
Contacts per residue
(normalized by number of beads in the residue)

Molecular Dynamics based descriptors
Average and standard deviation, calculated using the autocorrelation function (for time series) or the width of the distribution, for the last microsecond of the trajectory


Area per lipid
Membrane (nm2): 0.6494970 ± 0.0014557
Upper leaflet (nm2): 0.6494970 ± 0.0014557
Lower leaflet (nm2): 0.6494970 ± 0.0014557
Average Z coordinate
Peptide (nm): 4.2996900 ± 0.0427491
First Residue (nm): 4.853050 ± 0.045916
Last Residue (nm): 3.818080 ± 0.084807
Membrane (nm): 6.8159000 ± 0.0152603
Upper leaflet Head Group (nm): 8.7537300 ± 0.0180185
Lower leaflet Head Group (nm): 4.8794400 ± 0.0123303
Bilayer Thickness (nm): 3.8742900 ± 0.0218335
Peptide insertion (nm): 0.5797530 ± 0.0444918
Contacts
Peptide - Water: 91.38000 ± 1.84529
Peptide - Head groups: 14.745000 ± 0.549771
Peptide - Tail groups: 9.642500 ± 0.446309
Tilt (°): 80.26920 ± 1.20901
PepDF:
5(ns):  CVS
Displacement (nm): 0.7440140 ± 0.0313554
Precession(°): 0.971373 ± 1.422420
50(ns)  CVS
Displacement (nm): 2.703240 ± 0.123608
Precession(°): 8.36351 ± 4.42023
100(ns)  CVS
Displacement(nm): 3.932730 ± 0.184352
Precession(°): 17.81980 ± 5.84575
200(ns)  CVS
Displacement(nm): 5.046990 ± 0.193846
Precession(°): 38.36520 ± 7.62203

  Download JSON File.

Peptide Analyses


Peptide Displacement Fingerprint (PepDF)
Lateral displacement vs Rotational Displacement along the trajectory, for different time windows .

Density maps:
2D-density maps of lipids around the peptide along XY and YZ axis, calculated for each lipid type along the last microsecond.


Lipid-Peptide Analyses:


z-Position
Z-coordinate, averaged for differetn parts of the the system: peptide, membrane, first and last backbone (BB) residues and upper of lower leaflet lipids’ headgroups (HGs).
Minimum distance
Minimum distance (nm) between the peptide backbone and the lipids (headgroups and tailgroups).
Number of contacts
Number of contacts between the peptide backbone and the water or the lipids separated by lipid headgroups (HG) or lipid tails, using a cut-off of 0.6 nm.
Lateral density
Lateral density for the different components of the system: headgroups, tail groups, peptide and water.