Trajectory SP1242

Force field: martini_v3
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 19210
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer: Finisterrae III CESGA
Peptides: P410 AP01259
Lipids: POPC
Heteromolecules:
Ions: CL
Water model: W

  Download all Compresed Files.


Sequence :
WKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI
Total charge (e): +4
Number of residues: 34
By amino acid:
  Basic: 6
  Acidic: 2
  Hydrophobic: 22
  Polar: 4
Electrostatic Dipolar Moment (e nm): 11.76
Longitudinal (e nm): 11.52
Transversal (e nm): 2.34
Hydrophobic Dipolar Moment (nm): 4.11
Longitudinal (nm): 3.6
Transversal (nm): 1.98
Secondary structure: Helix
Activity:

Download Files
  ITP file.
  JSON file.
  PDB file.

Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet

Lipids


Membrane model for: POPC (Healthy mammal)

POPC
2-oleoyl-sn-glycero-3-phosphocholine
Total charge (e): 0

  See POPC lipid
  Download ITP File.
  Download PDB File.
Last snapshot
Total contacts per residue
 
Contacts per residue
(normalized by number of beads in the residue)

Molecular Dynamics based descriptors
Average and standard deviation, calculated using the autocorrelation function (for time series) or the width of the distribution, for the last microsecond of the trajectory


Area per lipid
Membrane (nm2): 0.649607000 ± 0.000941393
Upper leaflet (nm2): 0.649607000 ± 0.000941393
Lower leaflet (nm2): 0.649607000 ± 0.000941393
Average Z coordinate
Peptide (nm): 9.0006000 ± 0.0386292
First Residue (nm): 8.939210 ± 0.045532
Last Residue (nm): 9.3061200 ± 0.0918028
Membrane (nm): 6.8179200 ± 0.0099053
Upper leaflet Head Group (nm): 8.7558600 ± 0.0114796
Lower leaflet Head Group (nm): 4.87961000 ± 0.00834511
Bilayer Thickness (nm): 3.8762500 ± 0.0141923
Peptide insertion (nm): 0.2447330 ± 0.0402988
Contacts
Peptide - Water: 65.65250 ± 1.58055
Peptide - Head groups: 17.070000 ± 0.365534
Peptide - Tail groups: 14.097500 ± 0.488804
Tilt (°): 86.34090 ± 1.09634
PepDF:
5(ns):  CVS
Displacement (nm): 0.7096750 ± 0.0309674
Precession(°): 0.0477302 ± 1.2394500
50(ns)  CVS
Displacement (nm): 2.264170 ± 0.109121
Precession(°): -1.47465 ± 3.67561
100(ns)  CVS
Displacement(nm): 3.254370 ± 0.161902
Precession(°): -3.10197 ± 5.38961
200(ns)  CVS
Displacement(nm): 4.628960 ± 0.252162
Precession(°): -8.23575 ± 7.67681

  Download JSON File.

Peptide Analyses


Peptide Displacement Fingerprint (PepDF)
Lateral displacement vs Rotational Displacement along the trajectory, for different time windows .

Density maps:
2D-density maps of lipids around the peptide along XY and YZ axis, calculated for each lipid type along the last microsecond.


Lipid-Peptide Analyses:


z-Position
Z-coordinate, averaged for differetn parts of the the system: peptide, membrane, first and last backbone (BB) residues and upper of lower leaflet lipids’ headgroups (HGs).
Minimum distance
Minimum distance (nm) between the peptide backbone and the lipids (headgroups and tailgroups).
Number of contacts
Number of contacts between the peptide backbone and the water or the lipids separated by lipid headgroups (HG) or lipid tails, using a cut-off of 0.6 nm.
Lateral density
Lateral density for the different components of the system: headgroups, tail groups, peptide and water.