Trajectory SP1239

Force field: martini_v3
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 17406
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer: Finisterrae III CESGA
Peptides: P408 AP01019
Lipids: POPE, POPG
Heteromolecules:
Ions: NA
Water model: W

  Download all Compresed Files.


Sequence :
ETFDKLKEKLKTFYQKLVEKAEDLKGDLKAKLS
Total charge (e): +2
Number of residues: 33
By amino acid:
  Basic: 9
  Acidic: 7
  Hydrophobic: 12
  Polar: 5
Electrostatic Dipolar Moment (e nm): 4.57
Longitudinal (e nm): 4.3
Transversal (e nm): 1.57
Hydrophobic Dipolar Moment (nm): 2.28
Longitudinal (nm): 0.12
Transversal (nm): 2.28
Secondary structure: Helix
Activity:

Download Files
  ITP file.
  JSON file.
  PDB file.

Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet

Lipids


Membrane model for: POPG:POPE (1:3) (Gram-negative bacteria)

POPE
1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine
Total charge (e): 0

  See POPE lipid
  Download ITP File.
  Download PDB File.
POPG
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol
Total charge (e): -1

  See POPG lipid
  Download ITP File.
  Download PDB File.
Last snapshot
Total contacts per residue
 
Contacts per residue
(normalized by number of beads in the residue)

Molecular Dynamics based descriptors
Average and standard deviation, calculated using the autocorrelation function (for time series) or the width of the distribution, for the last microsecond of the trajectory


Area per lipid
Membrane (nm2): 0.61455800 ± 0.00106314
Upper leaflet (nm2): 0.61455800 ± 0.00106314
Lower leaflet (nm2): 0.61455800 ± 0.00106314
Average Z coordinate
Peptide (nm): 8.747930 ± 0.030695
First Residue (nm): 8.8987000 ± 0.0426917
Last Residue (nm): 8.8719400 ± 0.0597614
Membrane (nm): 6.3933000 ± 0.0109714
Upper leaflet Head Group (nm): 8.4013500 ± 0.0129582
Lower leaflet Head Group (nm): 4.3834200 ± 0.0089338
Bilayer Thickness (nm): 4.0179300 ± 0.0157393
Peptide insertion (nm): 0.3465760 ± 0.0333181
Contacts
Peptide - Water: 70.33000 ± 1.03393
Peptide - Head groups: 17.010000 ± 0.391831
Peptide - Tail groups: 14.147500 ± 0.364067
Tilt (°): 89.844200 ± 0.853746
PepDF:
5(ns):  CVS
Displacement (nm): 0.6180130 ± 0.0269582
Precession(°): 0.874135 ± 1.152170
50(ns)  CVS
Displacement (nm): 2.06572 ± 0.11384
Precession(°): 7.46199 ± 4.25672
100(ns)  CVS
Displacement(nm): 3.253800 ± 0.153154
Precession(°): 19.1647 ± 5.4779
200(ns)  CVS
Displacement(nm): 5.068720 ± 0.233256
Precession(°): 46.80000 ± 4.99117

  Download JSON File.

Peptide Analyses


Peptide Displacement Fingerprint (PepDF)
Lateral displacement vs Rotational Displacement along the trajectory, for different time windows .

Density maps:
2D-density maps of lipids around the peptide along XY and YZ axis, calculated for each lipid type along the last microsecond.


Lipid-Peptide Analyses:


z-Position
Z-coordinate, averaged for differetn parts of the the system: peptide, membrane, first and last backbone (BB) residues and upper of lower leaflet lipids’ headgroups (HGs).
Minimum distance
Minimum distance (nm) between the peptide backbone and the lipids (headgroups and tailgroups).
Number of contacts
Number of contacts between the peptide backbone and the water or the lipids separated by lipid headgroups (HG) or lipid tails, using a cut-off of 0.6 nm.
Lateral density
Lateral density for the different components of the system: headgroups, tail groups, peptide and water.