Trajectory SP1203

Force field: martini_v3
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 17402
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer: Finisterrae III CESGA
Peptides: P390 AP00310
Lipids: POPE, POPG
Heteromolecules:
Ions: NA
Water model: W

  Download all Compresed Files.


Sequence :
LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTE-
S

Total charge (e): +6
Number of residues: 36
By amino acid:
  Basic: 11
  Acidic: 5
  Hydrophobic: 15
  Polar: 5
Electrostatic Dipolar Moment (e nm): 9.51
Longitudinal (e nm): 9.47
Transversal (e nm): 0.82
Hydrophobic Dipolar Moment (nm): 2.64
Longitudinal (nm): 0.33
Transversal (nm): 2.62
Secondary structure: Helix
Activity:

Download Files
  ITP file.
  JSON file.
  PDB file.

Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet

Lipids


Membrane model for: POPG:POPE (1:3) (Gram-negative bacteria)

POPE
1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine
Total charge (e): 0

  See POPE lipid
  Download ITP File.
  Download PDB File.
POPG
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol
Total charge (e): -1

  See POPG lipid
  Download ITP File.
  Download PDB File.
Last snapshot
Total contacts per residue
 
Contacts per residue
(normalized by number of beads in the residue)

Molecular Dynamics based descriptors
Average and standard deviation, calculated using the autocorrelation function (for time series) or the width of the distribution, for the last microsecond of the trajectory


Area per lipid
Membrane (nm2): 0.61476400 ± 0.00121133
Upper leaflet (nm2): 0.61476400 ± 0.00121133
Lower leaflet (nm2): 0.61476400 ± 0.00121133
Average Z coordinate
Peptide (nm): 3.9969100 ± 0.0300055
First Residue (nm): 4.2881600 ± 0.0417036
Last Residue (nm): 3.5512200 ± 0.0534738
Membrane (nm): 6.3883000 ± 0.0120628
Upper leaflet Head Group (nm): 8.3977700 ± 0.0143232
Lower leaflet Head Group (nm): 4.3805800 ± 0.0100562
Bilayer Thickness (nm): 4.0172000 ± 0.0175009
Peptide insertion (nm): 0.3836710 ± 0.0316458
Contacts
Peptide - Water: 80.60250 ± 1.06374
Peptide - Head groups: 17.48000 ± 0.37019
Peptide - Tail groups: 14.567500 ± 0.292774
Tilt (°): 86.303700 ± 0.708487
PepDF:
5(ns):  CVS
Displacement (nm): 0.5847100 ± 0.0265438
Precession(°): 0.578168 ± 1.033990
50(ns)  CVS
Displacement (nm): 1.62128 ± 0.08256
Precession(°): 5.01875 ± 3.36811
100(ns)  CVS
Displacement(nm): 2.1189500 ± 0.0993656
Precession(°): 11.29170 ± 3.43883
200(ns)  CVS
Displacement(nm): 2.405050 ± 0.149512
Precession(°): 20.71230 ± 3.40073

  Download JSON File.

Peptide Analyses


Peptide Displacement Fingerprint (PepDF)
Lateral displacement vs Rotational Displacement along the trajectory, for different time windows .

Density maps:
2D-density maps of lipids around the peptide along XY and YZ axis, calculated for each lipid type along the last microsecond.


Lipid-Peptide Analyses:


z-Position
Z-coordinate, averaged for differetn parts of the the system: peptide, membrane, first and last backbone (BB) residues and upper of lower leaflet lipids’ headgroups (HGs).
Minimum distance
Minimum distance (nm) between the peptide backbone and the lipids (headgroups and tailgroups).
Number of contacts
Number of contacts between the peptide backbone and the water or the lipids separated by lipid headgroups (HG) or lipid tails, using a cut-off of 0.6 nm.
Lateral density
Lateral density for the different components of the system: headgroups, tail groups, peptide and water.