Trajectory SP1203
Force field:
martini_v3
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 17402
Time step (fs) : 25
Software: GROMACS 2021.5
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 17402
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer:
Finisterrae III CESGA
Peptides: P390 AP00310
Lipids: POPE, POPG
Heteromolecules:
Ions: NA
Water model: W
Peptides: P390 AP00310
Lipids: POPE, POPG
Heteromolecules:
Ions: NA
Water model: W
Sequence :
LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTE-
S
Total charge (e): +6
Number of residues: 36
By amino acid: Basic: 11 Acidic: 5 Hydrophobic: 15 Polar: 5 Electrostatic Dipolar Moment (e nm): 9.51
Longitudinal (e nm): 9.47 Transversal (e nm): 0.82 Hydrophobic Dipolar Moment (nm): 2.64
Longitudinal (nm): 0.33 Transversal (nm): 2.62 Secondary structure: Helix
Activity:
Download Files
ITP file. JSON file. PDB file.
Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet
Lipids
Membrane model for: POPG:POPE (1:3) (Gram-negative bacteria)
POPE
1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine
Total charge (e): 0
See POPE lipid
Download ITP File. Download PDB File.
POPG
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol
Total charge (e): -1
See POPG lipid
Download ITP File. Download PDB File.
Last snapshot
Total contacts per residue
Number of total contacts per residue type:
Number of contacts between each residue of the peptide backbone and the different lipid types, averaged over the last microsecond and using a cut-off of 0.6 nm.
Contacts per residue
(normalized by total number of beads of the amino acid):
Number of contacts between each residue of the peptide backbone and the different lipid types, averaged over the last microsecond and using a cut-off of 0.6 nm.
Molecular Dynamics based descriptors
Average and standard deviation,
calculated using the autocorrelation function (for time
series)
or the width of the distribution, for the last microsecond
of
the trajectory
Area per lipid
Membrane (nm2): 0.61476400 ± 0.00121133
Upper leaflet (nm2): 0.61476400 ± 0.00121133
Lower leaflet (nm2): 0.61476400 ± 0.00121133
Average Z coordinate
Peptide (nm): 3.9969100 ± 0.0300055
First Residue (nm): 4.2881600 ± 0.0417036
Last Residue (nm): 3.5512200 ± 0.0534738
Membrane (nm): 6.3883000 ± 0.0120628
Upper leaflet Head Group (nm): 8.3977700 ± 0.0143232
Lower leaflet Head Group (nm): 4.3805800 ± 0.0100562
Bilayer Thickness (nm): 4.0172000 ± 0.0175009
Peptide insertion (nm): 0.3836710 ± 0.0316458
Contacts
Peptide - Water: 80.60250 ± 1.06374
Peptide - Head groups: 17.48000 ± 0.37019
Peptide - Tail groups: 14.567500 ± 0.292774
Tilt (°): 86.303700 ± 0.708487
Membrane (nm2): 0.61476400 ± 0.00121133
Upper leaflet (nm2): 0.61476400 ± 0.00121133
Lower leaflet (nm2): 0.61476400 ± 0.00121133
Average Z coordinate
Peptide (nm): 3.9969100 ± 0.0300055
First Residue (nm): 4.2881600 ± 0.0417036
Last Residue (nm): 3.5512200 ± 0.0534738
Membrane (nm): 6.3883000 ± 0.0120628
Upper leaflet Head Group (nm): 8.3977700 ± 0.0143232
Lower leaflet Head Group (nm): 4.3805800 ± 0.0100562
Bilayer Thickness (nm): 4.0172000 ± 0.0175009
Peptide insertion (nm): 0.3836710 ± 0.0316458
Contacts
Peptide - Water: 80.60250 ± 1.06374
Peptide - Head groups: 17.48000 ± 0.37019
Peptide - Tail groups: 14.567500 ± 0.292774
Tilt (°): 86.303700 ± 0.708487
PepDF:
5(ns): CVS
Displacement (nm): 0.5847100 ± 0.0265438
Precession(°): 0.578168 ± 1.033990
50(ns) CVS
Displacement (nm): 1.62128 ± 0.08256
Precession(°): 5.01875 ± 3.36811
100(ns) CVS
Displacement(nm): 2.1189500 ± 0.0993656
Precession(°): 11.29170 ± 3.43883
200(ns) CVS
Displacement(nm): 2.405050 ± 0.149512
Precession(°): 20.71230 ± 3.40073
Download JSON File.
5(ns): CVS
Displacement (nm): 0.5847100 ± 0.0265438
Precession(°): 0.578168 ± 1.033990
50(ns) CVS
Displacement (nm): 1.62128 ± 0.08256
Precession(°): 5.01875 ± 3.36811
100(ns) CVS
Displacement(nm): 2.1189500 ± 0.0993656
Precession(°): 11.29170 ± 3.43883
200(ns) CVS
Displacement(nm): 2.405050 ± 0.149512
Precession(°): 20.71230 ± 3.40073
Download JSON File.
Peptide Analyses
Peptide Displacement Fingerprint
(PepDF)
Lateral displacement vs
Rotational
Displacement along the trajectory, for different time
windows .
Tilt angle: 
Peptide tilt angle evolution, defined as the angle between the peptide helical axis and the bilayer normal .
Peptide spin: 
Evolution of the angle formed by the transversal component of the hydrophobic dipolar moment and a vector transversal to the peptide pointing outwards the membrane.
Lipid Analyses:
Area per lipid
In this system both leaflets have the same number of lipids, thus the values for their APL are overlaping in the plot
Density maps:
2D-density maps of lipids around the
peptide
along XY and YZ axis, calculated for each lipid type along the
last
microsecond.
Lipid-Peptide Analyses:
z-Position
Z-coordinate, averaged for
differetn
parts of the the system: peptide, membrane, first and
last
backbone (BB) residues and upper of lower leaflet
lipids’
headgroups (HGs).
Minimum distance
Minimum distance (nm) between the
peptide backbone and the lipids (headgroups and
tailgroups).
Number of contacts
Number of contacts between the
peptide backbone and the water or the lipids separated
by
lipid headgroups (HG) or lipid tails, using a cut-off of
0.6
nm.
Lateral density
Lateral density for the different
components of the system: headgroups, tail groups,
peptide
and water.