Trajectory SP1202
Force field:
martini_v3
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 19215
Time step (fs) : 25
Software: GROMACS 2021.5
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 19215
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer:
Finisterrae III CESGA
Peptides: P390 AP00310
Lipids: POPC
Heteromolecules:
Ions: CL
Water model: W
Peptides: P390 AP00310
Lipids: POPC
Heteromolecules:
Ions: CL
Water model: W
Sequence :
LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTE-
S
Total charge (e): +6
Number of residues: 36
By amino acid: Basic: 11 Acidic: 5 Hydrophobic: 15 Polar: 5 Electrostatic Dipolar Moment (e nm): 9.51
Longitudinal (e nm): 9.47 Transversal (e nm): 0.82 Hydrophobic Dipolar Moment (nm): 2.64
Longitudinal (nm): 0.33 Transversal (nm): 2.62 Secondary structure: Helix
Activity:
Download Files
ITP file. JSON file. PDB file.
Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet
Lipids
Membrane model for: POPC (Healthy mammal)
POPC
2-oleoyl-sn-glycero-3-phosphocholine
Total charge (e): 0
See POPC lipid
Download ITP File. Download PDB File.
Last snapshot
Total contacts per residue
Number of total contacts per residue type:
Number of contacts between each residue of the peptide backbone and the different lipid types, averaged over the last microsecond and using a cut-off of 0.6 nm.
Molecular Dynamics based descriptors
Average and standard deviation,
calculated using the autocorrelation function (for time
series)
or the width of the distribution, for the last microsecond
of
the trajectory
Area per lipid
Membrane (nm2): 0.649953000 ± 0.000984595
Upper leaflet (nm2): 0.649953000 ± 0.000984595
Lower leaflet (nm2): 0.649953000 ± 0.000984595
Average Z coordinate
Peptide (nm): 9.1519100 ± 0.0314628
First Residue (nm): 8.8818800 ± 0.0452808
Last Residue (nm): 9.5629100 ± 0.0455088
Membrane (nm): 6.8142200 ± 0.0106686
Upper leaflet Head Group (nm): 8.7494500 ± 0.0128988
Lower leaflet Head Group (nm): 4.87676000 ± 0.00848286
Bilayer Thickness (nm): 3.8726900 ± 0.0154382
Peptide insertion (nm): 0.4024590 ± 0.0340042
Contacts
Peptide - Water: 83.34500 ± 1.18827
Peptide - Head groups: 17.052500 ± 0.340974
Peptide - Tail groups: 13.750000 ± 0.340592
Tilt (°): 86.944100 ± 0.696545
Membrane (nm2): 0.649953000 ± 0.000984595
Upper leaflet (nm2): 0.649953000 ± 0.000984595
Lower leaflet (nm2): 0.649953000 ± 0.000984595
Average Z coordinate
Peptide (nm): 9.1519100 ± 0.0314628
First Residue (nm): 8.8818800 ± 0.0452808
Last Residue (nm): 9.5629100 ± 0.0455088
Membrane (nm): 6.8142200 ± 0.0106686
Upper leaflet Head Group (nm): 8.7494500 ± 0.0128988
Lower leaflet Head Group (nm): 4.87676000 ± 0.00848286
Bilayer Thickness (nm): 3.8726900 ± 0.0154382
Peptide insertion (nm): 0.4024590 ± 0.0340042
Contacts
Peptide - Water: 83.34500 ± 1.18827
Peptide - Head groups: 17.052500 ± 0.340974
Peptide - Tail groups: 13.750000 ± 0.340592
Tilt (°): 86.944100 ± 0.696545
PepDF:
5(ns): CVS
Displacement (nm): 0.6795010 ± 0.0282239
Precession(°): -0.0590849 ± 1.2693000
50(ns) CVS
Displacement (nm): 2.054260 ± 0.102477
Precession(°): 0.324728 ± 4.043490
100(ns) CVS
Displacement(nm): 3.133270 ± 0.153481
Precession(°): 0.286103 ± 5.397340
200(ns) CVS
Displacement(nm): 4.416550 ± 0.225858
Precession(°): 3.77602 ± 6.24869
Download JSON File.
5(ns): CVS
Displacement (nm): 0.6795010 ± 0.0282239
Precession(°): -0.0590849 ± 1.2693000
50(ns) CVS
Displacement (nm): 2.054260 ± 0.102477
Precession(°): 0.324728 ± 4.043490
100(ns) CVS
Displacement(nm): 3.133270 ± 0.153481
Precession(°): 0.286103 ± 5.397340
200(ns) CVS
Displacement(nm): 4.416550 ± 0.225858
Precession(°): 3.77602 ± 6.24869
Download JSON File.
Peptide Analyses
Peptide Displacement Fingerprint
(PepDF)
Lateral displacement vs
Rotational
Displacement along the trajectory, for different time
windows .














