Trajectory SP1065

Force field: martini_v2.2P
Simulation length (ns): 5000
Electric field (kJ mol-1 nm-1 e-1): 0
Temperature (K): 300 (v-rescale)
Pressure (bar): 1 (Parrinello-rahman semiisotropic)
Number of particles: 45409
Time step (fs) : 25
Software: GROMACS 2021.5
Supercomputer: Finisterrae III CESGA
Peptides: P322 AP03746
Lipids: POPC
Heteromolecules:
Ions: CL
Water model: PW

  Download all Compresed Files.


Sequence :
WKFGKKLERIGQNVFRAAEKVLPVATGYAQLPATL-
AGAKQG
Total charge (e): +5
Number of residues: 41
By amino acid:
  Basic: 7
  Acidic: 2
  Hydrophobic: 25
  Polar: 7
Electrostatic Dipolar Moment (e nm): 12.37
Longitudinal (e nm): 12.06
Transversal (e nm): 2.74
Hydrophobic Dipolar Moment (nm): 2.52
Longitudinal (nm): 0.27
Transversal (nm): 2.5
Secondary structure: Helix
Activity:

Download Files
  ITP file.
  JSON file.
  PDB file.

Click on any component to highlight it from the plot.
Upper leaflet
Lower leaflet

Lipids


Membrane model for: POPC (Healthy mammal)

POPC
2-oleoyl-sn-glycero-3-phosphocholine
Total charge (e): 0

  See POPC lipid
  Download ITP File.
  Download PDB File.
Last snapshot
  Download PDB File.
Total contacts per residue
 
  Download PDB File.
Contacts per residue
(normalized by number of beads in the residue)
  Download PDB File.

Molecular Dynamics based descriptors
Average and standard deviation, calculated using the autocorrelation function (for time series) or the width of the distribution, for the last microsecond of the trajectory

Area per lipid
Membrane (nm2): 0.652516000 ± 0.000974914
Upper leaflet (nm2): 0.652516000 ± 0.000974914
Lower leaflet (nm2): 0.652516000 ± 0.000974914
Average Z coordinate
Peptide (nm): 4.7017100 ± 0.0307825
First Residue (nm): 4.49602 ± 0.05553
Last Residue (nm): 4.3873000 ± 0.0418817
Membrane (nm): 6.5356300 ± 0.0096538
Upper leaflet Head Group (nm): 8.4974100 ± 0.0115651
Lower leaflet Head Group (nm): 4.57012000 ± 0.00775858
Bilayer Thickness (nm): 3.9273000 ± 0.0139265
Peptide insertion (nm): -0.1315910 ± 0.0317452
Contacts
Peptide - Water: 0.0 ± 0.0
Peptide - Head groups: 23.330000 ± 0.537767
Peptide - Tail groups: 21.625000 ± 0.556069
Tilt (°): 89.089200 ± 0.618309
PepDF:
5(ns):  CVS
Displacement (nm): 0.5475850 ± 0.0239863
Precession(°): -1.581730 ± 0.631459
50(ns)  CVS
Displacement (nm): 1.66172 ± 0.08639
Precession(°): -17.09240 ± 2.13176
100(ns)  CVS
Displacement(nm): 2.1307500 ± 0.0923368
Precession(°): -36.99320 ± 3.30507
200(ns)  CVS
Displacement(nm): 2.966620 ± 0.132604
Precession(°): -80.30510 ± 4.75469

  Download JSON File.

Peptide Analyses

Peptide Displacement Fingerprint (PepDF)
Lateral displacement vs Rotational Displacement along the trajectory, for different time windows .

Density maps:
2D-density maps of lipids around the peptide along XY and YZ axis, calculated for each lipid type along the last microsecond.

Lipid-Peptide Analyses:

z-Position
Z-coordinate, averaged for differetn parts of the the system: peptide, membrane, first and last backbone (BB) residues and upper of lower leaflet lipids’ headgroups (HGs).
Minimum distance
Minimum distance (nm) between the peptide backbone and the lipids (headgroups and tailgroups).
Number of contacts
Number of contacts between the peptide backbone and the water or the lipids separated by lipid headgroups (HG) or lipid tails, using a cut-off of 0.6 nm.
Lateral density
Lateral density for the different components of the system: headgroups, tail groups, peptide and water.